PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G354000.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 460aa    MW: 52038.6 Da    PI: 7.3849
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G354000.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4225e-129894582373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cAea+s++  e+  +l+++ +  +s +g+p+qRl ay++e+L ar  +s++++y+al+++e +   s e l+++k++++++P++k
  Sevir.2G354000.2.p  89 KQLLTKCAEALSEERIEEFLKLVQQARGVVSITGEPIQRLGAYLLEGLVARHGNSGTNIYRALKCREPE---SNELLSYMKILYNICPYFK 176
                         689*****************************************************************9...99***************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         f++++aN aI ea+ +e+++Hi+Df+i qG+QW++L+qaLa+Rp+gpp++RiTg+++p s+  + e l  +g+ L+++ ee+++p+ef++l
  Sevir.2G354000.2.p 177 FGYMAANGAIAEALRNEDKIHIVDFQIAQGTQWITLIQALAARPGGPPHVRITGIDDPVSEyaRGEGLDLVGKMLKSMSEEFRIPLEFTPL 267
                         **********************************************************999999**************************9 PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                              ++++ e+L+++pgEalaVn+ lqlh+++desv+++++rd +L++vk+lsPkv ++veqe+ +n+++Fl rf+e+++yysa+f+s++
  Sevir.2G354000.2.p 268 PGVYATQVTKEMLDIRPGEALAVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVTTLVEQESHTNTTPFLMRFSETMDYYSAMFESID 358
                         888999************************************************************************************* PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                         a+lpr+s+eri+vE+++l+++ivn++aceg++r+erhe l+kW++rl++aGFkp+pls+++++ ++ ll+ ++ d y++ee++g+++lgWk
  Sevir.2G354000.2.p 359 ANLPRDSKERINVEQHCLAKDIVNIIACEGKDRVERHELLGKWKSRLTMAGFKPYPLSSYVNSVIRKLLACYS-DKYTLEEKDGAMLLGWK 448
                         *********************************************************************9999.55*************** PP

                GRAS 364 drpLvsvSaW 373
                         +r+L+s+SaW
  Sevir.2G354000.2.p 449 SRKLISASAW 458
                         ********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.25662440IPR005202Transcription factor GRAS
PfamPF035141.7E-12689458IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MQHALRKIET VLMAPDADDA ATSTKHEFEE HKPAPLMRQR SRTWSHELRQ PSPGVVRTQF  60
ASGYPTASYE FRPEKRQREL REDPQSMVKQ LLTKCAEALS EERIEEFLKL VQQARGVVSI  120
TGEPIQRLGA YLLEGLVARH GNSGTNIYRA LKCREPESNE LLSYMKILYN ICPYFKFGYM  180
AANGAIAEAL RNEDKIHIVD FQIAQGTQWI TLIQALAARP GGPPHVRITG IDDPVSEYAR  240
GEGLDLVGKM LKSMSEEFRI PLEFTPLPGV YATQVTKEML DIRPGEALAV NFTLQLHHTP  300
DESVDVNNPR DGLLRMVKGL SPKVTTLVEQ ESHTNTTPFL MRFSETMDYY SAMFESIDAN  360
LPRDSKERIN VEQHCLAKDI VNIIACEGKD RVERHELLGK WKSRLTMAGF KPYPLSSYVN  420
SVIRKLLACY SDKYTLEEKD GAMLLGWKSR KLISASAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-6111145926375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278600.0KJ727860.1 Zea mays clone pUT5952 GRAS transcription factor (GRAS49) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957943.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 1
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLK3ZRC60.0K3ZRC6_SETIT; Uncharacterized protein
STRINGSi029156m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein